Return to main results Retrieve Phyre Job Id

Job DescriptionP0ABQ0
Confidence95.67%DateWed Jan 25 15:20:22 GMT 2012
Rank218Aligned Residues56
% Identity20%Templatec2zklA_
PDB info PDB header:isomeraseChain: A: PDB Molecule:capsular polysaccharide synthesis enzyme cap5f; PDBTitle: crystal structure of capsular polysaccharide assembling protein capf2 from staphylococcus aureus
Resolution2.61 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   189190.........200.........210.........220.........230.........240.........250.........260........
Predicted Secondary structure 



































Query SS confidence 















































































Query Sequence  LNIMITAGPTREPLDPVRYISNHSSGKMGFAIAAAAARRGANVTLVSGPVSLPTPPFVKRVDVMTALEMEAAVNASVQQQ
Query Conservation 
 





 
 
 

 

 


 



 
  

      

 
 

 
      
     
 
 
  

   
       
Alig confidence 








................


























.................










Template Conservation 








................




 

  
   
  

    
  
.................   
  
    
Template Sequence  MNIVITGAK. . . . . . . . . . . . . . . . GFVGKNLKADLTSTTDHHIFEVHRQTK. . . . . . . . . . . . . . . . . EEELESALLKA
Template Known Secondary structure 
TTT................S



TT

.................
Template Predicted Secondary structure 



................









.................


Template SS confidence 















































































   1........ 10.........20.........30...... ...40.......
 
   269270.......
Predicted Secondary structure 



Query SS confidence 








Query Sequence  NIFIGCAAV
Query Conservation 
  
 



Alig confidence 








Template Conservation 
 





 
Template Sequence  DFIVHLAGV
Template Known Secondary structure  S



Template Predicted Secondary structure 

Template SS confidence 








   48.50......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions