Return to main results Retrieve Phyre Job Id

Job DescriptionP0ABQ0
Confidence96.78%DateWed Jan 25 15:20:22 GMT 2012
Rank73Aligned Residues50
% Identity22%Templatec2ydyA_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:methionine adenosyltransferase 2 subunit beta; PDBTitle: crystal structure of human s-adenosylmethionine synthetase2 2, beta subunit in orthorhombic crystal form
Resolution2.25 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   188.190.........200.........210.........220.........230.........240.........250.........260.......
Predicted Secondary structure 



































Query SS confidence 















































































Query Sequence  HLNIMITAGPTREPLDPVRYISNHSSGKMGFAIAAAAARRGANVTLVSGPVSLPTPPFVKRVDVMTALEMEAAVNASVQQ
Query Conservation 

 





 
 
 

 

 


 



 
  

      

 
 

 
      
     
 
 
  

   
      
Alig confidence 








................























..................






.....
Template Conservation   







................

 

  
   
   
  
    
..................   
   ..... 
Template Sequence  NRRVLVTGA. . . . . . . . . . . . . . . . TGLLGRAVHKEFQQNNWHAVGCGV. . . . . . . . . . . . . . . . . . HHIIHDF. . . . . Q
Template Known Secondary structure 

TT................TSTTT


.......................
Template Predicted Secondary structure 



................




..................
.....
Template SS confidence 















































































   28.30...... ...40.........50.........60 ....... .
 
   268.270......
Predicted Secondary structure 



Query SS confidence 








Query Sequence  QNIFIGCAA
Query Conservation   
  
 


Alig confidence 








Template Conservation   
 


 
 
Template Sequence  PHVIVHCAV
Template Known Secondary structure 
S


Template Predicted Secondary structure 




Template SS confidence 








   87..90.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions