Return to main results Retrieve Phyre Job Id

Job DescriptionP0ABQ0
Confidence78.01%DateWed Jan 25 15:20:22 GMT 2012
Rank420Aligned Residues30
% Identity23%Templatec2vdcI_
PDB info PDB header:oxidoreductaseChain: I: PDB Molecule:glutamate synthase [nadph] small chain; PDBTitle: the 9.5 a resolution structure of glutamate synthase from2 cryo-electron microscopy and its oligomerization behavior3 in solution: functional implications.
Resolution9.50 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   188.190.........200.........210.........220.........230....
Predicted Secondary structure 



















Query SS confidence 














































Query Sequence  HLNIMITAGPTREPLDPVRYISNHSSGKMGFAIAAAAARRGANVTLV
Query Conservation 

 





 
 
 

 

 


 



 
  

      

 
 

Alig confidence 








.................




















Template Conservation 








.................







  


 
  
 

Template Sequence  GLSVGVIGA. . . . . . . . . . . . . . . . . GPAGLAAAEELRAKGYEVHVY
Template Known Secondary structure 




.................ST

Template Predicted Secondary structure 



.................




Template SS confidence 














































   147..150..... ....160.........170......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions