Return to main results Retrieve Phyre Job Id

Job DescriptionP0ABQ0
Confidence77.80%DateWed Jan 25 15:20:22 GMT 2012
Rank421Aligned Residues61
% Identity18%Templatec2q4oA_
PDB info PDB header:structural genomics, unknown functionChain: A: PDB Molecule:uncharacterized protein at2g37210/t2n18.3; PDBTitle: ensemble refinement of the crystal structure of a lysine2 decarboxylase-like protein from arabidopsis thaliana gene at2g37210
Resolution1.95 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   191........200.........210.........220.........230.........240.........250.........260.........270
Predicted Secondary structure 



































Query SS confidence 















































































Query Sequence  IMITAGPTREPLDPVRYISNHSSGKMGFAIAAAAARRGANVTLVSGPVSLPTPPFVKRVDVMTALEMEAAVNASVQQQNI
Query Conservation 





 
 
 

 

 


 



 
  

      

 
 

 
      
     
 
 
  

   
       
 
Alig confidence 






..............





.















.......




























Template Conservation   

 


..............  


 .
 
 

   

 



....... 
      
 
       

  
   


Template Sequence  DLVYGGG. . . . . . . . . . . . . . SIGLXG. LVSQAVHDGGRHVIGI. . . . . . . IPKTLXVGEVRAVADXHQRKAEXAKHSDA
Template Known Secondary structure 


..............SS.TT

.......TT



SST
S
Template Predicted Secondary structure 


..............
.


.......













Template SS confidence 















































































   47..50... ...... 60.........70..... ....80.........90.........100....
 
   271..
Predicted Secondary structure 
Query SS confidence 


Query Sequence  FIG
Query Conservation   
 
Alig confidence 


Template Conservation   
 
Template Sequence  FIA
Template Known Secondary structure 
Template Predicted Secondary structure 
Template SS confidence 


   113..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions