Return to main results Retrieve Phyre Job Id

Job DescriptionP0ABQ0
Confidence96.29%DateWed Jan 25 15:20:22 GMT 2012
Rank156Aligned Residues37
% Identity22%Templatec2c07A_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:3-oxoacyl-(acyl-carrier protein) reductase; PDBTitle: oxoacyl-acp reductase of plasmodium falciparum
Resolution1.5 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   185....190.........200.........210.........220.........230.......
Predicted Secondary structure 
























Query SS confidence 




















































Query Sequence  DLKHLNIMITAGPTREPLDPVRYISNHSSGKMGFAIAAAAARRGANVTLVSGP
Query Conservation   
 

 





 
 
 

 

 


 



 
  

      

 
 

 
 
Alig confidence 











...............


.





















Template Conservation   
 

 





...............
 
.

 
 
  
   

 

   
 
Template Sequence  CGENKVALVTGA. . . . . . . . . . . . . . . GRG. IGREIAKMLAKSVSHVICISRT
Template Known Secondary structure 

SS
ST...............TS.TTTSSSS
Template Predicted Secondary structure 






...............

.




Template SS confidence 




















































   60.........70. ... .....80.........90......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions