Return to main results Retrieve Phyre Job Id

Job DescriptionP15067
Confidence81.09%DateThu Jan 5 11:34:29 GMT 2012
Rank342Aligned Residues43
% Identity19%Templated1jz8a5
SCOP infoTIM beta/alpha-barrel (Trans)glycosidases beta-glycanases
Resolution1.50

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   180.........190.........200.........210.........220.........230.........240.........250.........
Predicted Secondary structure 
















































Query SS confidence 















































































Query Sequence  GHPVMINYLKQLGITALELLPVAQFASEPRLQRMGLSNYWGYNPVAMFALHPAYACSPETALDEFRDAIKALHKAGIEVI
Query Conservation      





 


  
 
 

                 


    
 


  


       


 

  

  

 

Alig confidence 


















....................





....................














Template Conservation      

 


  
 
 

 .................... 
 
  ....................  

   

 



 
Template Sequence  TMVQDILLMKQNNFNAVRC. . . . . . . . . . . . . . . . . . . . SHYPNH. . . . . . . . . . . . . . . . . . . . PLWYTLCDRYGLYVV
Template Known Secondary structure  TT


....................TTS


....................T
Template Predicted Secondary structure 



....................




....................


Template SS confidence 















































































   371........380......... 390..... ....400.........410
 
   260..
Predicted Secondary structure 
Query SS confidence 


Query Sequence  LDI
Query Conservation 


Alig confidence 


Template Conservation   
 
Template Sequence  DEA
Template Known Secondary structure 
Template Predicted Secondary structure 

Template SS confidence 


   411..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions