Return to main results Retrieve Phyre Job Id

Job DescriptionP15067
Confidence96.94%DateThu Jan 5 11:34:29 GMT 2012
Rank181Aligned Residues56
% Identity23%Templatec3qr3B_
PDB info PDB header:hydrolaseChain: B: PDB Molecule:endoglucanase eg-ii; PDBTitle: crystal structure of cel5a (eg2) from hypocrea jecorina (trichoderma2 reesei)
Resolution2.05 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   185....190.........200.........210.........220.........230.........240.........250.........260..
Predicted Secondary structure 
















































Query SS confidence 













































































Query Sequence  INYLKQLGITALELLPVAQFASEPRLQRMGLSNYWGYNPVAMFALHPAYACSPETALDEFRDAIKALHKAGIEVILDI
Query Conservation 




 


  
 
 

                 


    
 


  


       


 

  

  

 




Alig confidence 













.


.....................






































Template Conservation         
 
 


.
  .....................                 
  

  
  
   

 




Template Sequence  QHFVNEDGMTIFRL. PVG. . . . . . . . . . . . . . . . . . . . . WQYLVNNNLGGNLDSTSISKYDQLVQGCLSLGAYCIVDI
Template Known Secondary structure 


.
.....................TTT
TT



TT
Template Predicted Secondary structure 



.

.....................













Template SS confidence 













































































   48.50.........60. ... .....70.........80.........90.........100...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions