Return to main results Retrieve Phyre Job Id

Job DescriptionP15067
Confidence63.70%DateThu Jan 5 11:34:29 GMT 2012
Rank465Aligned Residues54
% Identity19%Templatec3jrkG_
PDB info PDB header:lyaseChain: G: PDB Molecule:tagatose 1,6-diphosphate aldolase 2; PDBTitle: a putative tagatose 1,6-diphosphate aldolase from streptococcus2 pyogenes
Resolution1.97 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   185....190.........200.........210.........220.........230.........240.........250.........260....
Predicted Secondary structure 
















































Query SS confidence 















































































Query Sequence  INYLKQLGITALELLPVAQFASEPRLQRMGLSNYWGYNPVAMFALHPAYACSPETALDEFRDAIKALHKAGIEVILDIVL
Query Conservation 




 


  
 
 

                 


    
 


  


       


 

  

  

 





 
Alig confidence 















....................













......























Template Conservation 

 
 
 








....................   

   
    
......   
  
 
 
   




 
 
 
Template Sequence  AKRIKEAGAEAVKFLL. . . . . . . . . . . . . . . . . . . . YYDIDGDQDVNEQK. . . . . . KAYIERIGSECRAEDIPFYLEILT
Template Known Secondary structure  TT
S....................
TTS
......TT

Template Predicted Secondary structure 



....................




......



Template SS confidence 















































































   109110.........120.... .....130........ .140.........150.........160..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions