Return to main results Retrieve Phyre Job Id

Job DescriptionP15067
Confidence86.79%DateThu Jan 5 11:34:29 GMT 2012
Rank313Aligned Residues59
% Identity19%Templatec3gdbA_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:putative uncharacterized protein spr0440; PDBTitle: crystal structure of spr0440 glycoside hydrolase domain,2 endo-d from streptococcus pneumoniae r6
Resolution1.87 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   248.250.........260.........270.........280.........290.........300.........310.........320.......
Predicted Secondary structure 











































Query SS confidence 















































































Query Sequence  IKALHKAGIEVILDIVLNHSAELDLDGPLFSLRGIDNRSYYWIREDGDYHNWTGCGNTLNLSHPAVVDYASACLRYWVET
Query Conservation 
  

  

 





 

                           
      
   


  

 

  
      

 
Alig confidence 








































.......................











....
Template Conservation 
 






 



   
              
     
  .......................  
 


 

  ....
Template Sequence  IDAGHRNGVPVYGTLFFNWSNSIADQERFAEALKQDADGSF. . . . . . . . . . . . . . . . . . . . . . . PIARKLVDMAKY. . . .
Template Known Secondary structure  TT



T


TTS

...........................
Template Predicted Secondary structure 
















...........................
Template SS confidence 















































































   274.....280.........290.........300.........310.... .....320......
 
   328.330...
Predicted Secondary structure 



Query SS confidence 





Query Sequence  CHVDGF
Query Conservation   




Alig confidence 





Template Conservation 





Template Sequence  YGYDGY
Template Known Secondary structure  T

Template Predicted Secondary structure 


Template SS confidence 





   327..330..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions