Return to main results Retrieve Phyre Job Id

Job DescriptionP15067
Confidence77.26%DateThu Jan 5 11:34:29 GMT 2012
Rank361Aligned Residues42
% Identity31%Templatec3ff4A_
PDB info PDB header:structural genomics, unknown functionChain: A: PDB Molecule:uncharacterized protein; PDBTitle: crystal structure of uncharacterized protein chu_1412
Resolution2.10 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   180.........190.........200.........210.........220.........230.........240.........250.........
Predicted Secondary structure 
















































Query SS confidence 















































































Query Sequence  GHPVMINYLKQLGITALELLPVAQFASEPRLQRMGLSNYWGYNPVAMFALHPAYACSPETALDEFRDAIKALHKAGIEVI
Query Conservation      





 


  
 
 

                 


    
 


  


       


 

  

  

 

Alig confidence 




















.................................


.....

..













Template Conservation       
 
    
 
 
    .................................
  ..... 
..

     
 

 

Template Sequence  NQLSEYNYILSLKPKRVIFNP. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . GTE. . . . . NE. . ELEEILSENGIEPV
Template Known Secondary structure  GGG

S
T.................................T

.....
..TT
Template Predicted Secondary structure 





.................................


.....
..


Template SS confidence 















































































   67..70.........80....... ..90 .. .......100......
 
   260.
Predicted Secondary structure 
Query SS confidence 

Query Sequence  LD
Query Conservation 

Alig confidence 

Template Conservation    
Template Sequence  IG
Template Known Secondary structure  S
Template Predicted Secondary structure 
Template SS confidence 

   107.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions