Return to main results Retrieve Phyre Job Id

Job DescriptionP15067
Confidence92.26%DateThu Jan 5 11:34:29 GMT 2012
Rank284Aligned Residues63
% Identity16%Templatec3cz8A_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:putative sporulation-specific glycosylase ydhd; PDBTitle: crystal structure of putative sporulation-specific glycosylase ydhd2 from bacillus subtilis
Resolution2.20 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   245....250.........260.........270.........280.........290.........300.........310.........320....
Predicted Secondary structure 











































Query SS confidence 















































































Query Sequence  RDAIKALHKAGIEVILDIVLNHSAELDLDGPLFSLRGIDNRSYYWIREDGDYHNWTGCGNTLNLSHPAVVDYASACLRYW
Query Conservation 
 

  

  

 





 

                           
      
   


  

 

  
      
Alig confidence 

































.............................
















Template Conservation        
          
    
           .............................      
  

  

  
Template Sequence  AAAIETTWQRRVTPLATITNLTSGGFSTEIVHQV. . . . . . . . . . . . . . . . . . . . . . . . . . . . . LNNPTARTNLVNNIYDL
Template Known Secondary structure  TT

TT
.............................T
Template Predicted Secondary structure 











.............................

Template SS confidence 















































































   148.150.........160.........170.........180. ........190........
 
   325....330......
Predicted Secondary structure 




Query SS confidence 











Query Sequence  VETCHVDGFRFD
Query Conservation 
 
 





 
Alig confidence 











Template Conservation 
     





Template Sequence  VSTRGYGGVTID
Template Known Secondary structure  T
S
Template Predicted Secondary structure 



Template SS confidence 











   199200.........210
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions