Return to main results Retrieve Phyre Job Id

Job DescriptionP15067
Confidence82.59%DateThu Jan 5 11:34:29 GMT 2012
Rank333Aligned Residues59
% Identity20%Templatec3b9eA_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:chitinase a; PDBTitle: crystal structure of inactive mutant e315m chitinase a from2 vibrio harveyi
Resolution1.70 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   244.....250.... .....260.........270.........280.........290.........300.........310.........320..
Predicted Secondary structure 
.










































Query SS confidence 










.



































































Query Sequence  FRDAIKALHKA. GIEVILDIVLNHSAELDLDGPLFSLRGIDNRSYYWIREDGDYHNWTGCGNTLNLSHPAVVDYASACLR
Query Conservation 

 

  

  .

 





 

                           
      
   


  

 

  
     
Alig confidence 










.







..................................

























Template Conservation     
  

   
 






..................................


  
  
   
    
  

 


Template Sequence  YAMLMALKQRNPDLKIIPSI. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . GGWTLSDPFYDFVDKKNRDTFVASVK
Template Known Secondary structure 
TT
..................................
TTS
GGGGGTTS
Template Predicted Secondary structure 



..................................










Template SS confidence 















































































   253......260.........270.. .......280.........290........
 
   323......330 ......
Predicted Secondary structure 


.

Query SS confidence 







.





Query Sequence  YWVETCHV. DGFRFD
Query Conservation   

 
 

.



 
Alig confidence 







.





Template Conservation   

  


 





Template Sequence  KFLKTWKFYDGVDID
Template Known Secondary structure  STT

Template Predicted Secondary structure 





Template SS confidence 














   299300.........310...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions