Return to main results Retrieve Phyre Job Id

Job DescriptionP15067
Confidence61.25%DateThu Jan 5 11:34:29 GMT 2012
Rank480Aligned Residues50
% Identity12%Templatec2qjhH_
PDB info PDB header:lyaseChain: H: PDB Molecule:putative aldolase mj0400; PDBTitle: m. jannaschii adh synthase covalently bound to2 dihydroxyacetone phosphate
Resolution2.60 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   185....190.........200.........210.........220.........230.........240.........250.........260....
Predicted Secondary structure 
















































Query SS confidence 















































































Query Sequence  INYLKQLGITALELLPVAQFASEPRLQRMGLSNYWGYNPVAMFALHPAYACSPETALDEFRDAIKALHKAGIEVILDIVL
Query Conservation 




 


  
 
 

                 


    
 


  


       


 

  

  

 





 
Alig confidence 
























..............................
























Template Conservation 

 








 
    
      ..............................       
       
 


    
Template Sequence  VEEAIRMGADAVSIHVNVGSDEDWE. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . AYRDLGMIAETCEYWGMPLIAMMYP
Template Known Secondary structure  TT
STSTTT..............................T

Template Predicted Secondary structure 








..............................


Template SS confidence 















































































   105....110.........120......... 130.........140.........150....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions