Return to main results Retrieve Phyre Job Id

Job DescriptionP15067
Confidence96.92%DateThu Jan 5 11:34:29 GMT 2012
Rank182Aligned Residues56
% Identity20%Templatec2oylB_
PDB info PDB header:hydrolaseChain: B: PDB Molecule:endoglycoceramidase ii; PDBTitle: endo-glycoceramidase ii from rhodococcus sp.: cellobiose-like2 imidazole complex
Resolution1.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   183......190.........200.........210.........220.........230.........240.........250.........260..
Predicted Secondary structure 
















































Query SS confidence 















































































Query Sequence  VMINYLKQLGITALELLPVAQFASEPRLQRMGLSNYWGYNPVAMFALHPAYACSPETALDEFRDAIKALHKAGIEVILDI
Query Conservation   





 


  
 
 

                 


    
 


  


       


 

  

  

 




Alig confidence 















........................







































Template Conservation 
    
   


 


........................ 
 
   

  
 

   
  
   
  
   

 



 
Template Sequence  DLAREYADMGTNFVRF. . . . . . . . . . . . . . . . . . . . . . . . LISWRSVEPAPGVYDQQYLDRVEDRVGWYAERGYKVMLDM
Template Known Secondary structure 


........................

SBTTB

TT
Template Predicted Secondary structure 



........................












Template SS confidence 















































































   7980.........90.... .....100.........110.........120.........130....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions