Return to main results Retrieve Phyre Job Id

Job DescriptionP15067
Confidence69.88%DateThu Jan 5 11:34:29 GMT 2012
Rank409Aligned Residues41
% Identity17%Templatec2h6rG_
PDB info PDB header:isomeraseChain: G: PDB Molecule:triosephosphate isomerase; PDBTitle: crystal structure of triosephosphate isomerase (tim) from2 methanocaldococcus jannaschii
Resolution2.30 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   188.190.........200.........210.........220.........230.........240.........250.........260..
Predicted Secondary structure 
















































Query SS confidence 










































































Query Sequence  LKQLGITALELLPVAQFASEPRLQRMGLSNYWGYNPVAMFALHPAYACSPETALDEFRDAIKALHKAGIEVILDI
Query Conservation 

 


  
 
 

                 


    
 


  


       


 

  

  

 




Alig confidence 












............................





......





















Template Conservation 
   
   




............................



  ......  
    
  
   

  



Template Sequence  IKDCGCKGTLINH. . . . . . . . . . . . . . . . . . . . . . . . . . . . SEKRML. . . . . . LADIEAVINKCKNLGLETIVCT
Template Known Secondary structure  T

SB............................TTB


......T
Template Predicted Secondary structure 





..................................


Template SS confidence 










































































   78.80.........90 ...... ...100.........110........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions