Return to main results Retrieve Phyre Job Id

Job DescriptionP15067
Confidence79.96%DateThu Jan 5 11:34:29 GMT 2012
Rank345Aligned Residues58
% Identity9%Templatec1xyzA_
PDB info PDB header:glycosyltransferaseChain: A: PDB Molecule:1,4-beta-d-xylan-xylanohydrolase; PDBTitle: a common protein fold and similar active site in two2 distinct families of beta-glycanases
Resolution1.40 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   242.......250.........260.........270.........280.........290.........300.........310.........320.
Predicted Secondary structure 











































Query SS confidence 















































































Query Sequence  DEFRDAIKALHKAGIEVILDIVLNHSAELDLDGPLFSLRGIDNRSYYWIREDGDYHNWTGCGNTLNLSHPAVVDYASACL
Query Conservation   


 

  

  

 





 

                           
      
   


  

 

  
    
Alig confidence 



























..............................





















Template Conservation     
  
      

 
    
      ..............................
 
                  
Template Sequence  SKGDQLLAFAERNGMQMRGHTLIWHNQN. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . PSWLTNGNWNRDSLLAVMKNHI
Template Known Secondary structure  TT

SSS
..............................
TS


Template Predicted Secondary structure 






..............................









Template SS confidence 















































































   577..580.........590.........600.... .....610.........620......
 
   322.......
Predicted Secondary structure 

Query SS confidence 







Query Sequence  RYWVETCH
Query Conservation    

 
 
Alig confidence 







Template Conservation       

 
Template Sequence  TTVMTHYK
Template Known Secondary structure  TT
Template Predicted Secondary structure 
Template SS confidence 







   627..630....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions