Return to main results Retrieve Phyre Job Id

Job DescriptionP15067
Confidence96.68%DateThu Jan 5 11:34:29 GMT 2012
Rank192Aligned Residues50
% Identity14%Templatec1wkyA_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:endo-beta-1,4-mannanase; PDBTitle: crystal structure of alkaline mannanase from bacillus sp. strain jamb-2 602: catalytic domain and its carbohydrate binding module
Resolution1.65 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   183......190.........200.........210.........220.........230.........240.........250.........260..
Predicted Secondary structure 
















































Query SS confidence 















































































Query Sequence  VMINYLKQLGITALELLPVAQFASEPRLQRMGLSNYWGYNPVAMFALHPAYACSPETALDEFRDAIKALHKAGIEVILDI
Query Conservation   





 


  
 
 

                 


    
 


  


       


 

  

  

 




Alig confidence 















.




...............







..............




















Template Conservation    
  
   
 
 


.     ...............        ..............  
   
  
   

 



 
Template Sequence  TAIEGIANTGANTVRI. VLSDG. . . . . . . . . . . . . . . GQWTKDDI. . . . . . . . . . . . . . QTVRNLISLAEDNNLVAVLEV
Template Known Secondary structure  TTT
S.

S...............SSS



..............TT
Template Predicted Secondary structure 



.

...............





..............



Template SS confidence 















































































   6970.........80.... ..... 90....... ..100.........110........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions