Return to main results Retrieve Phyre Job Id

Job DescriptionP64490
Confidence9.37%DateThu Jan 5 12:08:53 GMT 2012
Rank16Aligned Residues29
% Identity28%Templatec2zv3E_
PDB info PDB header:hydrolaseChain: E: PDB Molecule:peptidyl-trna hydrolase; PDBTitle: crystal structure of project mj0051 from methanocaldococcus2 jannaschii dsm 2661
Resolution2.10 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   26...30.........40.........50.........60....
Predicted Secondary structure 














Query SS confidence 






































Query Sequence  NESTAKGIFKYLKELGVPASAADITARADQEGWNPGFTE
Query Conservation   





 





 





 




  



  


 
Alig confidence 






















..........





Template Conservation   
  
  
   
   

    
 ..........


 

Template Sequence  SEKELIDIYNKARSEGLPCSIIR. . . . . . . . . . DAGHTQ
Template Known Secondary structure  STT

..........

SST
Template Predicted Secondary structure 




..........




Template SS confidence 






































   58.60.........70.........80 ......
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions