Return to main results Retrieve Phyre Job Id

Job DescriptionP64490
Confidence5.01%DateThu Jan 5 12:08:53 GMT 2012
Rank87Aligned Residues29
% Identity38%Templatec2xa6B_
PDB info PDB header:transcriptionChain: B: PDB Molecule:kh domain-containing\,rna-binding\,signal PDBTitle: structural basis for homodimerization of the src-associated2 during mitosis, 68 kd protein (sam68) qua1 domain
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   35....40.........50.........60.........70....
Predicted Secondary structure 














Query SS confidence 







































Query Sequence  KYLKELGVPASAADITARADQEGWNPGFTEKMVGWAKKME
Query Conservation 




 





 




  



  


 
  


 
 
Alig confidence 





...........






















Template Conservation 





...........







 




 


  

 
Template Sequence  KYLPEL. . . . . . . . . . . MAEKDSLDPSFTHAMQLLTAEIE
Template Known Secondary structure  ...........S
TT
Template Predicted Secondary structure  ...........


Template SS confidence 







































   102..... ..110.........120.........130
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions