Return to main results Retrieve Phyre Job Id

Job DescriptionQ9JMT7
Confidence2.97%DateThu Jan 5 12:38:12 GMT 2012
Rank43Aligned Residues43
% Identity40%Templatec3q6nF_
PDB info PDB header:chaperoneChain: F: PDB Molecule:heat shock protein hsp 90-alpha; PDBTitle: crystal structure of human mc-hsp90 in p21 space group
Resolution3.05 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   26...30.........40.........50.........60.........70.........80.......
Predicted Secondary structure 













Query SS confidence 





























































Query Sequence  KKEDIPEDMFAIIYGSDSIKKYEHGQMELTKNINSGCIEALVFLSEEDPEKYSDYINDYHKI
Query Conservation      
      
             
  
  


  

  

 

   
 

  
   
 

Alig confidence 






..................




















.














Template Conservation 

 



..................
  
   
  

   
  

 .
 
 
  
       
Template Sequence  DSEDLPI. . . . . . . . . . . . . . . . . . LKVIRKNLVKKCLELFTELAE. DKENYKKFYEQFSKN
Template Known Secondary structure  SS


..................
.S
Template Predicted Secondary structure 




...................
Template SS confidence 





























































   390...... ...400.........410....... ..420.........430..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions