Return to main results Retrieve Phyre Job Id

Job DescriptionP46857
Confidence6.14%DateThu Jan 5 12:04:29 GMT 2012
Rank45Aligned Residues42
% Identity19%Templated1iega_
SCOP infoHerpes virus serine proteinase, assemblin Herpes virus serine proteinase, assemblin Herpes virus serine proteinase, assemblin
Resolution2.00

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   8.10.........20.........30.........40.........50.........60.....
Predicted Secondary structure 





















Query SS confidence 

























































Query Sequence  FAKANHYLDDADLPVVITLHGRFSQGWYFCFEAREFLETGDEAARLAGNAPFIIDKDS
Query Conservation         
   
  

     
   



 


  

 


    





  
 
  
Alig confidence 







...























.............









Template Conservation    

   
...







     

 

 
    ............. 





 
 
Template Sequence  RDVVEHWL. . . ALPLNINHDDTAVVGHVAAMQSVR. . . . . . . . . . . . . DGLFCLGCVT
Template Known Secondary structure  T
...

TTT.............T
Template Predicted Secondary structure 

...











.............



Template SS confidence 

























































   36...40... ......50.........60....... ..70.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions