Return to main results Retrieve Phyre Job Id

Job DescriptionP46857
Confidence4.08%DateThu Jan 5 12:04:29 GMT 2012
Rank75Aligned Residues33
% Identity18%Templatec3njqB_
PDB info PDB header:viral protein/inhibitorChain: B: PDB Molecule:orf 17; PDBTitle: crystal structure of kaposi's sarcoma-associated herpesvirus protease2 in complex with dimer disruptor
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   20.........30.........40.........50.........60.....
Predicted Secondary structure 

















Query SS confidence 













































Query Sequence  LPVVITLHGRFSQGWYFCFEAREFLETGDEAARLAGNAPFIIDKDS
Query Conservation    

     
   



 


  

 


    





  
 
  
Alig confidence 






















.............









Template Conservation 






     

 

 
 
  ............. 





 

Template Sequence  LPITIEHLPETEVGWTLGLFQVS. . . . . . . . . . . . . HGIFCTGAIT
Template Known Secondary structure 
TTBTTB

T.............T
Template Predicted Secondary structure 








.............



Template SS confidence 













































   40.........50.........60.. .......70..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions