Return to main results Retrieve Phyre Job Id

Job DescriptionP46857
Confidence3.93%DateThu Jan 5 12:04:29 GMT 2012
Rank78Aligned Residues25
% Identity32%Templatec3ivrA_
PDB info PDB header:ligaseChain: A: PDB Molecule:putative long-chain-fatty-acid coa ligase; PDBTitle: crystal structure of putative long-chain-fatty-acid coa ligase from2 rhodopseudomonas palustris cga009
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   30.........40.........50.........60...
Predicted Secondary structure 













Query SS confidence 

































Query Sequence  FSQGWYFCFEAREFLETGDEAARLAGNAPFIIDK
Query Conservation     



 


  

 


    





  
 
Alig confidence 





.........


















Template Conservation 
 


 ......... 




  
 

 
 
 

Template Sequence  FRNGWH. . . . . . . . . HTGDMGRFDADGYLFYAGR
Template Known Secondary structure  TGGGS.........
TTS
Template Predicted Secondary structure 



.........








Template SS confidence 

































   373..... .380.........390.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions