Return to main results Retrieve Phyre Job Id

Job DescriptionP46857
Confidence18.72%DateThu Jan 5 12:04:29 GMT 2012
Rank15Aligned Residues23
% Identity39%Templatec2jx8A_
PDB info PDB header:transcriptionChain: A: PDB Molecule:phosphorylated ctd-interacting factor 1; PDBTitle: solution structure of hpcif1 ww domain
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   32.......40.........50.........60.......
Predicted Secondary structure 















Query SS confidence 



































Query Sequence  QGWYFCFEAREFLETGDEAARLAGNAPFIIDKDSGE
Query Conservation   



 


  

 


    





  
 
  

Alig confidence 










.............











Template Conservation   









............. 






 
 
Template Sequence  AGWEKCWSRRE. . . . . . . . . . . . . NRPYYFNRFTNQ
Template Known Secondary structure  T

TTT.............TTTTT
Template Predicted Secondary structure 
.............








Template SS confidence 



































   8.10........ .20.........30
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions