Return to main results Retrieve Phyre Job Id

Job DescriptionP31131
Confidence12.42%DateThu Jan 5 11:47:15 GMT 2012
Rank14Aligned Residues23
% Identity22%Templatec3h3yF_
PDB info PDB header:viral proteinChain: F: PDB Molecule:baseplate structural protein gp6; PDBTitle: fitting of the gp6 crystal structure into 3d cryo-em2 reconstruction of bacteriophage t4 star-shaped baseplate
Resolution16.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   110.........120.........130.........140
Predicted Secondary structure 














Query SS confidence 






























Query Sequence  SIAITGYGGPEGGEDGTPAGTVWFAWHIKGQ
Query Conservation 


 

 


       


 
 


     
Alig confidence 



.......






.











Template Conservation 

  ....... 

   
.











Template Sequence  AVQT. . . . . . . FTDSTKP. GYAFIAAKPKSG
Template Known Secondary structure  .......
TTST.T
SSS
Template Predicted Secondary structure  .......






.




Template SS confidence 






























   359360.. ....... 370.........380.
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions