Return to main results Retrieve Phyre Job Id

Job DescriptionP23827
Confidence6.90%DateThu Jan 5 11:39:38 GMT 2012
Rank44Aligned Residues24
% Identity33%Templatec3a9lB_
PDB info PDB header:hydrolaseChain: B: PDB Molecule:poly-gamma-glutamate hydrolase; PDBTitle: structure of bacteriophage poly-gamma-glutamate hydrolase
Resolution1.90 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   76...80..... ....90.........
Predicted Secondary structure 
.......






Query SS confidence 









. . . . . . .













Query Sequence  GGKLENKTLE. . . . . . . GWGYDYYVFDKVSS
Query Conservation   
 


  
 .......



 

 
     
Alig confidence 









.......













Template Conservation 

 

 





  

     
 
 




 
Template Sequence  AGGIEVGTTELIYRVVELTGGSLYLFQGLLP
Template Known Secondary structure  TTSTT



S
Template Predicted Secondary structure 














Template SS confidence 






























   41........50.........60.........70.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions