Return to main results Retrieve Phyre Job Id

Job DescriptionP23827
Confidence90.16%DateThu Jan 5 11:39:38 GMT 2012
Rank7Aligned Residues30
% Identity27%Templatec2la7A_
PDB info PDB header:structural genomics, unknown functionChain: A: PDB Molecule:uncharacterized protein; PDBTitle: nmr structure of the protein yp_557733.1 from burkholderia xenovorans
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   70.........80.........90.........100.........110
Predicted Secondary structure 




















Query SS confidence 








































Query Sequence  CNLHRLGGKLENKTLEGWGYDYYVFDKVSSPVSTMMACPDG
Query Conservation 

   
 
 


  
 



 

 
       

 


   
Alig confidence 















...........













Template Conservation 

   
 
      
 ...........     

 


   
Template Sequence  CNRYMGSYALKDGKLS. . . . . . . . . . . FGTLGGTRMACMTP
Template Known Secondary structure  SSTT...........
S






S
Template Predicted Secondary structure 




...........




Template SS confidence 








































   71........80...... ...90.........100
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions