Return to main results Retrieve Phyre Job Id

Job DescriptionP76545
Confidence1.82%DateThu Jan 5 12:24:21 GMT 2012
Rank97Aligned Residues25
% Identity52%Templatec1bl1A_
PDB info PDB header:hormone receptorChain: A: PDB Molecule:parathyroid hormone receptor; PDBTitle: pth receptor n-terminus fragment, nmr, 1 structure
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   34.....40.........50.........60......
Predicted Secondary structure 







Query SS confidence 
































Query Sequence  AIRDLANDIKERGCVELVQPGGFDELVQIYEAG
Query Conservation 
































Alig confidence 













........










Template Conservation 













........










Template Sequence  AVKFLTNETREREV. . . . . . . . FDRLGMIYTVG
Template Known Secondary structure  S

........SS
Template Predicted Secondary structure  ........
Template SS confidence 
































   3......10...... ...20.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions