Return to main results Retrieve Phyre Job Id

Job DescriptionP31680
Confidence21.39%DateThu Jan 5 11:48:37 GMT 2012
Rank105Aligned Residues42
% Identity19%Templatec3trbA_
PDB info PDB header:dna binding proteinChain: A: PDB Molecule:virulence-associated protein i; PDBTitle: structure of an addiction module antidote protein of a higa (higa)2 family from coxiella burnetii
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   154.....160.........170.........180.........190.........200.........210.....
Predicted Secondary structure 






















Query SS confidence 





























































Query Sequence  LYVIAEELGISRAQFDQFLRMMQGGAQFGGGYQQQTGGGNWQQAQRGPTLEDACNVLGVKPT
Query Conservation 
  

  



   
  
                                   
 



   
Alig confidence 



















....................





















Template Conservation 
  

  



   

  
 ....................
    
     

    


  
Template Sequence  ANQLAKHLAIPTNRVTAILN. . . . . . . . . . . . . . . . . . . . GARSITADTALRLAKFFGTTPE
Template Known Secondary structure  TS
T....................TSS


T

Template Predicted Secondary structure  ....................








Template SS confidence 





























































   27..30.........40...... ...50.........60........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions