Return to main results Retrieve Phyre Job Id

Job DescriptionP31680
Confidence46.53%DateThu Jan 5 11:48:37 GMT 2012
Rank51Aligned Residues44
% Identity23%Templatec2q0oA_
PDB info PDB header:transcriptionChain: A: PDB Molecule:probable transcriptional activator protein trar; PDBTitle: crystal structure of an anti-activation complex in bacterial quorum2 sensing
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   145....150.........160.........170.........180.........190.........200.........210.........220....
Predicted Secondary structure 



























Query SS confidence 















































































Query Sequence  SLHPNERAVLYVIAEELGISRAQFDQFLRMMQGGAQFGGGYQQQTGGGNWQQAQRGPTLEDACNVLGVKPTDDATTIKRA
Query Conservation   
   
   
  

  



   
  
                                   
 



   
    

 
Alig confidence 
















........................................






















Template Conservation   

 

 


 


 
 ........................................
  


  
 

  

  

  
Template Sequence  MLSPREMLCLVWASKGK. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . TASVTANLTGINARTVQHYLDKA
Template Known Secondary structure  S

TT
........................................



Template Predicted Secondary structure 





........................................



Template SS confidence 















































































   175....180.........190. ........200.........210....
 
   225...
Predicted Secondary structure 
Query SS confidence 



Query Sequence  YRKL
Query Conservation 

 
Alig confidence 



Template Conservation    

Template Sequence  RAKL
Template Known Secondary structure 
Template Predicted Secondary structure 
Template SS confidence 



   215...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions