Return to main results Retrieve Phyre Job Id

Job DescriptionP31680
Confidence20.65%DateThu Jan 5 11:48:37 GMT 2012
Rank111Aligned Residues42
% Identity14%Templatec2ebyA_
PDB info PDB header:transcriptionChain: A: PDB Molecule:putative hth-type transcriptional regulator ybaq; PDBTitle: crystal structure of a hypothetical protein from e. coli
Resolution2.25 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   154.....160.........170.........180.........190.........200.........210.....
Predicted Secondary structure 






















Query SS confidence 





























































Query Sequence  LYVIAEELGISRAQFDQFLRMMQGGAQFGGGYQQQTGGGNWQQAQRGPTLEDACNVLGVKPT
Query Conservation 
  

  



   
  
                                   
 



   
Alig confidence 



















....................





















Template Conservation 
 


   


   

  
 ....................
   

   
 


  
 

  
Template Sequence  INELAELLHVHRNSVSALIN. . . . . . . . . . . . . . . . . . . . NNRKLTTEMAFRLAKVFDTTVD
Template Known Secondary structure  TS
T....................TSS


T

Template Predicted Secondary structure 


....................







Template SS confidence 





























































   34.....40.........50... ......60.........70.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions