Return to main results Retrieve Phyre Job Id

Job DescriptionP77180
Confidence4.34%DateThu Jan 5 12:26:02 GMT 2012
Rank39Aligned Residues25
% Identity16%Templated1p9qc3
SCOP infoFerredoxin-like EF-G C-terminal domain-like Hypothetical protein AF0491, C-terminal domain
Resolution2.00

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   147..150.........160.........170........
Predicted Secondary structure 










Query SS confidence 































Query Sequence  PSAINSELYTKMIYLTRNWSLYPNGDGCVTIS
Query Conservation   
 







  


     
 

   
 
 
Alig confidence 
















.......







Template Conservation 


 
 
   

  


.......
 



 
Template Sequence  PSGMYGDLMDLLGKVAK. . . . . . . GEALTKVL
Template Known Secondary structure  GGGTT.......T

Template Predicted Secondary structure 



.......


Template SS confidence 































   206...210.........220.. .......230
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions