Return to main results Retrieve Phyre Job Id

Job DescriptionP77180
Confidence2.94%DateThu Jan 5 12:26:02 GMT 2012
Rank64Aligned Residues20
% Identity35%Templatec3mfnD_
PDB info PDB header:structural genomics, unknown functionChain: D: PDB Molecule:uncharacterized protein; PDBTitle: dfer_2879 protein of unknown function from dyadobacter fermentans
Resolution2.02 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   189190.........200.........210.........
Predicted Secondary structure 
Query SS confidence 






























Query Sequence  AICLALGFFLSIVISVMFCLVKKMVDEYQQN
Query Conservation 

 


      


    
 

 
 

   
Alig confidence 










...........








Template Conservation 
 
 


  

...........
  
 
   
Template Sequence  GVLFALDHYFG. . . . . . . . . . . KDVDWYKSN
Template Known Secondary structure 
...........

Template Predicted Secondary structure 
...........

Template SS confidence 






























   54.....60.... .....70...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions