Return to main results Retrieve Phyre Job Id

Job DescriptionP77180
Confidence19.24%DateThu Jan 5 12:26:02 GMT 2012
Rank7Aligned Residues34
% Identity24%Templatec3d7qB_
PDB info PDB header:unknown functionChain: B: PDB Molecule:xisi protein-like; PDBTitle: crystal structure of a xisi-like protein (npun_ar114) from nostoc2 punctiforme pcc 73102 at 2.30 a resolution
Resolution2.30 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   77..80.........90.........100. ........110
Predicted Secondary structure 






...........



Query SS confidence 
























. . . . . . . . . . .








Query Sequence  TMTEDVIQRITTFFHTSPDVKNREI. . . . . . . . . . . RLEWSGDKR
Query Conservation 

   



 
 
  

 
 

  
........... 
 
 



Alig confidence 
























...........








Template Conservation   

  

  

        

 
 


 






   

    
Template Sequence  TKVRQLLTKHLQYKPSYGDVEVEQIFDEEHDHYQIISVGWNNQHR
Template Known Secondary structure  TT


SSSTTTTTT
Template Predicted Secondary structure 















Template SS confidence 












































   910.........20.........30.........40.........50...
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions