Return to main results Retrieve Phyre Job Id

Job DescriptionP0AD33
Confidence2.25%DateWed Jan 25 15:20:24 GMT 2012
Rank65Aligned Residues45
% Identity13%Templatec3c0tA_
PDB info PDB header:transcriptionChain: A: PDB Molecule:mediator of rna polymerase ii transcription PDBTitle: structure of the schizosaccharomyces pombe mediator2 subcomplex med8c/18
Resolution2.40 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   18.20.........30.........40.........50.........60.........70.........
Predicted Secondary structure 
















Query SS confidence 





























































Query Sequence  GTIMDNSDCTASYSRVFANRAEAEQTLAALTEKARSVESEPCKITPTFTEESDGVRLDIDFT
Query Conservation 





 

       
 
   

  

 
  


 




  


 
   


  
 
 
 
Alig confidence 

















.................


























Template Conservation 
  
  
   
 
 

  .................          
 


 
    
 
 
 
Template Sequence  GLEYFFFDTTVRIYQTLI. . . . . . . . . . . . . . . . . PSQQRSIKPPFHPMNEEQPWILHVYTH
Template Known Secondary structure  TT.................SSTT

SS
SSTT

Template Predicted Secondary structure 

.................














Template SS confidence 





























































   128.130.........140..... ....150.........160.........170..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions