Return to main results Retrieve Phyre Job Id

Job DescriptionP0AD33
Confidence2.17%DateWed Jan 25 15:20:24 GMT 2012
Rank71Aligned Residues41
% Identity15%Templatec2zfdB_
PDB info PDB header:signaling protein/transferaseChain: B: PDB Molecule:putative uncharacterized protein t20l15_90; PDBTitle: the crystal structure of plant specific calcium binding protein atcbl22 in complex with the regulatory domain of atcipk14
Resolution1.20 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   34.....40.........50......... 60.........70....
Predicted Secondary structure 






................




Query SS confidence 

























. . . . . . . . . . . . . . . .














Query Sequence  FANRAEAEQTLAALTEKARSVESEPC. . . . . . . . . . . . . . . . KITPTFTEESDGVRL
Query Conservation 
 
   

  

 
  


 




 ................ 


 
   


  
Alig confidence 

























................














Template Conservation 
 
   
  

 


  
      
 

    
 


 

 
 
  






   
Template Sequence  FVSAWTAERVVERLEEIVSAENLTVAKKETWGMKIEGQKGNFAMVVEINQLTDELVM
Template Known Secondary structure  SS
TT
TTGGGT
SSS
Template Predicted Secondary structure 

















Template SS confidence 
























































   340.........350.........360.........370.........380.........390......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions