Return to main results Retrieve Phyre Job Id

Job DescriptionP36561
Confidence3.63%DateThu Jan 5 11:53:19 GMT 2012
Rank22Aligned Residues26
% Identity38%Templatec3d6rA_
PDB info PDB header:viral proteinChain: A: PDB Molecule:non-structural protein 1; PDBTitle: structure of an avian influenza a virus ns1 protein2 effector domain
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   16...20.........30.........40.........
Predicted Secondary structure 










Query SS confidence 

































Query Sequence  PVPRRWSQGLDFEHYSRGIITFPLIGLLLGAISG
Query Conservation 


                   







 
  
Alig confidence 



..












......








Template Conservation 
 

.. 


  






......








Template Sequence  PIPS. . MPGHSTEDVKNAI. . . . . . GILIGGLEW
Template Known Secondary structure 
TT..S



......
Template Predicted Secondary structure 



..





......
Template SS confidence 

































   162... ....170........ .180.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions