Return to main results Retrieve Phyre Job Id

Job DescriptionP13029
Confidence10.68%DateThu Jan 5 11:33:28 GMT 2012
Rank82Aligned Residues28
% Identity21%Templatec1pgjA_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:6-phosphogluconate dehydrogenase; PDBTitle: x-ray structure of 6-phosphogluconate dehydrogenase from the protozoan2 parasite t. brucei
Resolution2.82 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   592.......600.........610.........620.........630...
Predicted Secondary structure 
























Query SS confidence 









































Query Sequence  ESLLIDKAQQLTLTAPEMTALVGGMRVLGANFDGSKNGVFTD
Query Conservation     


 
 
 



 












    

  
 

 
Alig confidence 







..............



















Template Conservation 





 
..............






 
  
 

  
  
Template Sequence  VSLQRDVF. . . . . . . . . . . . . . GRHGYERVDKDGRESFQWPE
Template Known Secondary structure  ..............



SSSSS





Template Predicted Secondary structure 


..............













Template SS confidence 









































   449450...... ...460.........470......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions