Return to main results Retrieve Phyre Job Id

Job DescriptionP24238
Confidence7.31%DateThu Jan 5 11:41:30 GMT 2012
Rank74Aligned Residues17
% Identity41%Templatec3al6A_
PDB info PDB header:unknown functionChain: A: PDB Molecule:jmjc domain-containing protein c2orf60; PDBTitle: crystal structure of human tyw5
Resolution2.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   910.........20.........30........
Predicted Secondary structure 













Query SS confidence 





























Query Sequence  YEIGDIVFTCIGAALFGQISAASNCWSNHV
Query Conservation     




    
  
  
   
 
  


Alig confidence 











.............




Template Conservation 
 


 



  .............
 
 
Template Sequence  LEAGDVLFIPAL. . . . . . . . . . . . . WFHNV
Template Known Secondary structure 

TT

TT.............
Template Predicted Secondary structure 






.............

Template SS confidence 





























   221........230.. .....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions