Return to main results Retrieve Phyre Job Id

Job DescriptionP0ABY2
Confidence5.11%DateThu Jan 5 11:16:41 GMT 2012
Rank75Aligned Residues23
% Identity39%Templated1q3ma_
SCOP infoGLA-domain GLA-domain GLA-domain
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   84.....90.........100.........110...
Predicted Secondary structure 



Query SS confidence 





























Query Sequence  IRMDELAKLVGQSSVQKSVLSAYGDQGGFV
Query Conservation   




  

     
  
  


   
  
Alig confidence 










.......











Template Conservation 










.......











Template Sequence  PDCDELADHIG. . . . . . . FQEAYRRFYGPV
Template Known Secondary structure  TT
.......SSTSS

Template Predicted Secondary structure 

.......


Template SS confidence 





























   27..30....... ..40.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions