Return to main results Retrieve Phyre Job Id

Job DescriptionP62552
Confidence3.35%DateThu Jan 5 12:07:35 GMT 2012
Rank24Aligned Residues22
% Identity50%Templatec3c4yA_
PDB info PDB header:transferaseChain: A: PDB Molecule:rhodopsin kinase; PDBTitle: crystal structure of apo form of g protein coupled receptor kinase 12 at 7.51a
Resolution7.51 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   25....30.........40.........50.........60..
Predicted Secondary structure 









Query SS confidence 





































Query Sequence  SGLVSTTMQNEARRLRAERWKAENQEGMAEVARFIEMN
Query Conservation 





 








 



  














Alig confidence 










................










Template Conservation       

 
 
................          
Template Sequence  SGTCPIPWQEE. . . . . . . . . . . . . . . . MIETGVFGDLN
Template Known Secondary structure 

................SSS
Template Predicted Secondary structure 







................

Template SS confidence 





































   508.510........ .520.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions