Return to main results Retrieve Phyre Job Id

Job DescriptionP0A9Z1
Confidence16.92%DateThu Jan 5 11:11:41 GMT 2012
Rank41Aligned Residues57
% Identity21%Templatec3hulA_
PDB info PDB header:transferaseChain: A: PDB Molecule:homoserine kinase; PDBTitle: structure of putative homoserine kinase thrb from listeria2 monocytogenes
Resolution2.19 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   13......20.........30.........40.........50.........60.........70.........80.........90..
Predicted Secondary structure 































Query SS confidence 















































































Query Sequence  LDDVREALAEVGITGMTVTEVKGFGRQKGHTELYRGAEYMVDFLPKVKIEIVVPDDIVDTCVDTIIRTAQTGKIGDGKIF
Query Conservation     
  

   
  
 

  
 
 
                    
  
 


 

    

  
     
   


 

Alig confidence 


















...




.....................


















.....







Template Conservation     
       

 

 

...


  .....................
  
            
  ..... 
    
 
Template Sequence  LAQIRDVAKNQGAYAACLS. . . GAGPT. . . . . . . . . . . . . . . . . . . . . VLVFAPRNLANKLQTSLQT. . . . . LEIDADVL
Template Known Secondary structure  TTT


...TTSS
.....................
GGGT.....T

SS
Template Predicted Secondary structure 




...



.....................
.....




Template SS confidence 















































































   225....230.........240... ..... .250.........260....... ..270.....
 
   93.....
Predicted Secondary structure 
Query SS confidence 





Query Sequence  VFDVAR
Query Conservation 
 

  
Alig confidence 





Template Conservation        
Template Sequence  LLDVEG
Template Known Secondary structure  B

Template Predicted Secondary structure 

Template SS confidence 





   276...280.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions