Return to main results Retrieve Phyre Job Id

Job DescriptionP16916
Confidence30.21%DateWed Jan 25 15:20:39 GMT 2012
Rank6Aligned Residues34
% Identity21%Templatec3mswA_
PDB info PDB header:structural genomics, unknown functionChain: A: PDB Molecule:uncharacterized protein; PDBTitle: crystal structure of a protein with unknown function (bf3112) from2 bacteroides fragilis nctc 9343 at 1.90 a resolution
Resolution1.90 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   926...930.........940.........950.........960.........970.....
Predicted Secondary structure 
























Query SS confidence 

















































Query Sequence  DNRIARDAHYLYRYDRHGRLTEKTDLIPEGVIRTDDERTHRYHYDSQHRL
Query Conservation   
         
 

  


                     
 

   

Alig confidence 






















................










Template Conservation   
 
    



 


 





................ 
 


     
Template Sequence  SGILNPVKXYKYSYDTDQQKTVK. . . . . . . . . . . . . . . . STYAWNIFKNT
Template Known Secondary structure  T

TTTT................TTTT
Template Predicted Secondary structure 








................





Template SS confidence 

















































   56...60.........70........ .80.........
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions