Return to main results Retrieve Phyre Job Id

Job DescriptionP25549
Confidence14.09%DateThu Jan 5 11:42:06 GMT 2012
Rank62Aligned Residues33
% Identity24%Templated1v82a_
SCOP infoNucleotide-diphospho-sugar transferases Nucleotide-diphospho-sugar transferases 1,3-glucuronyltransferase
Resolution1.85

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   86...90.........100.........110.........120... ......130..
Predicted Secondary structure 























.


Query SS confidence 





































.








Query Sequence  PNVVVFLLDDVGWMDVGFNGGGVAVGNPTPDIDAVASQ. GLILTSAYS
Query Conservation 



 
  

      
 

        




 

  .
  
 
 
 
Alig confidence 













..............









.








Template Conservation 
 
 






   ..............
  
  

  


 
 

  
Template Sequence  PNLHWLVVEDAPRR. . . . . . . . . . . . . . TPLTARLLRDTGLNYTHLHV
Template Known Secondary structure  SSSSSS
..............



Template Predicted Secondary structure 







..............




Template SS confidence 















































   113......120...... ...130.........140......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions