Return to main results Retrieve Phyre Job Id

Job DescriptionP25549
Confidence17.99%DateThu Jan 5 11:42:06 GMT 2012
Rank47Aligned Residues32
% Identity16%Templatec3dqzB_
PDB info PDB header:lyaseChain: B: PDB Molecule:alpha-hydroxynitrile lyase-like protein; PDBTitle: structure of the hydroxynitrile lyase from arabidopsis2 thaliana
Resolution2.50 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   84.....90.........100.........110.........120.......
Predicted Secondary structure 



























Query SS confidence 











































Query Sequence  KKPNVVVFLLDDVGWMDVGFNGGGVAVGNPTPDIDAVASQGLIL
Query Conservation 





 
  

      
 

        




 

  
  
Alig confidence 

















............













Template Conservation 

 






       
............      
   
  
Template Sequence  RKHHFVLVHNAYHGAWIW. . . . . . . . . . . . YKLKPLLESAGHRV
Template Known Secondary structure 




TT

GGGG............TTTT
Template Predicted Secondary structure 









............


Template SS confidence 











































   3......10.........20 .........30....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions