Return to main results Retrieve Phyre Job Id

Job DescriptionP0A9J6
Confidence15.41%DateThu Jan 5 11:10:28 GMT 2012
Rank98Aligned Residues32
% Identity22%Templatec3i3lA_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:alkylhalidase cmls; PDBTitle: crystal structure of cmls, a flavin-dependent halogenase
Resolution2.20 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30.........40.........50.........60.
Predicted Secondary structure 























Query SS confidence 




























































Query Sequence  MQNAGSLVVLGSINADHILNLQSFPTPGETVTGNHYQVAFGGKGANQAVAAGRSGANIAFI
Query Conservation 
     




   

        
               

   


  
  

     
Alig confidence 



.





............................





















Template Conservation 
   .





............................





 

  


 

 
 

Template Sequence  MTRS. KVAIIG. . . . . . . . . . . . . . . . . . . . . . . . . . . . GGPAGSVAGLTLHKLGHDVTIY
Template Known Secondary structure 



.
............................
STT
Template Predicted Secondary structure 



.
............................




Template SS confidence 




























































   1... .....10 .........20.........30..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions