Return to main results Retrieve Phyre Job Id

Job DescriptionP0A9J6
Confidence33.97%DateThu Jan 5 11:10:28 GMT 2012
Rank75Aligned Residues32
% Identity25%Templatec2v1dA_
PDB info PDB header:oxidoreductase/repressorChain: A: PDB Molecule:lysine-specific histone demethylase 1; PDBTitle: structural basis of lsd1-corest selectivity in histone h32 recognition
Resolution3.10 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   2.......10.........20.........30.........40.........50.........60.
Predicted Secondary structure 






















Query SS confidence 



























































Query Sequence  QNAGSLVVLGSINADHILNLQSFPTPGETVTGNHYQVAFGGKGANQAVAAGRSGANIAFI
Query Conservation       




   

        
               

   


  
  

     
Alig confidence 









............................





















Template Conservation     
 




............................

 


 

  
   
  
 

Template Sequence  KKTGKVIIIG. . . . . . . . . . . . . . . . . . . . . . . . . . . . SGVSGLAAARQLQSFGMDVTLL
Template Known Secondary structure  S

S
............................
STT
Template Predicted Secondary structure 





............................




Template SS confidence 



























































   276...280..... ....290.........300.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions