Return to main results Retrieve Phyre Job Id

Job DescriptionP19930
Confidence28.51%DateWed Jan 25 15:20:41 GMT 2012
Rank157Aligned Residues32
% Identity25%Templated1ek6a_
SCOP infoNAD(P)-binding Rossmann-fold domains NAD(P)-binding Rossmann-fold domains Tyrosine-dependent oxidoreductases
Resolution1.50

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10. ........20.........30.........40...
Predicted Secondary structure 




.













Query SS confidence 










.































Query Sequence  MSEQRVVVMGL. GNLLWADEGFGVRVAERLYAHYHWPEYVEIVD
Query Conservation 

 







.

 
 





  
   
      
  
 


Alig confidence 

.







.


.......










...







Template Conservation 
 .
 









.......
  

  

  ...
  
    
Template Sequence  MA. EKVLVTGGAGYI. . . . . . . GSHTVLELLEA. . . GYLPVVID
Template Known Secondary structure 

.STTTS.......T...T

Template Predicted Secondary structure 

.




.......
...

Template SS confidence 











































   1. .......10.... .....20..... ....30...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions