Return to main results Retrieve Phyre Job Id

Job DescriptionP19930
Confidence40.14%DateWed Jan 25 15:20:41 GMT 2012
Rank113Aligned Residues27
% Identity26%Templatec3nklA_
PDB info PDB header:oxidoreductase/lyaseChain: A: PDB Molecule:udp-d-quinovosamine 4-dehydrogenase; PDBTitle: crystal structure of udp-d-quinovosamine 4-dehydrogenase from vibrio2 fischeri
Resolution1.90 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   2.......10.........20.........30.....
Predicted Secondary structure 














Query SS confidence 

































Query Sequence  SEQRVVVMGLGNLLWADEGFGVRVAERLYAHYHW
Query Conservation 
 









 
 





  
   
      
Alig confidence 












.......













Template Conservation 
   




 
  .......
  
   
      
Template Sequence  AKKKVLIYGAGSA. . . . . . . GLQLANXLRQGKEF
Template Known Secondary structure 



S.......SSS
Template Predicted Secondary structure 






.......


Template SS confidence 

































   0.........10.. .......20......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions