Return to main results Retrieve Phyre Job Id

Job DescriptionP19930
Confidence50.39%DateWed Jan 25 15:20:41 GMT 2012
Rank73Aligned Residues31
% Identity23%Templatec3k96B_
PDB info PDB header:oxidoreductaseChain: B: PDB Molecule:glycerol-3-phosphate dehydrogenase [nad(p)+]; PDBTitle: 2.1 angstrom resolution crystal structure of glycerol-3-phosphate2 dehydrogenase (gpsa) from coxiella burnetii
Resolution2.10 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   3......10.........20.........30.........40...
Predicted Secondary structure 
















Query SS confidence 








































Query Sequence  EQRVVVMGLGNLLWADEGFGVRVAERLYAHYHWPEYVEIVD
Query Conservation   









 
 





  
   
      
  
 


Alig confidence 











.......










...







Template Conservation    

 




  .......
   
  
   ...
  
    
Template Sequence  KHPIAILGAGSW. . . . . . . GTALALVLARK. . . GQKVRLWS
Template Known Secondary structure 
S


S.......TT...T


Template Predicted Secondary structure 




.......
...

Template SS confidence 








































   5....10...... ...20....... ..30.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions